General Information

  • ID:  hor004133
  • Uniprot ID:  Q99P86
  • Protein name:  Resistin-like beta
  • Gene name:  Retnlb
  • Organism:  Mus musculus (Mouse)
  • Family:  Resistin/FIZZ family
  • Source:  Animal
  • Expression:  Up-regulated in colon in response to a high-fat diet. Also up-regulated in obese mice mutant for the leptin receptor LEPR (db/db genotype). |Strongly expressed in colon, and at lower levels in ileum .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009617 response to bacterium
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
  • Length:  82(24-105)
  • Propeptide:  MKPTLCFLFILVSLFPLIVPGNAQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
  • Signal peptide:  MKPTLCFLFILVSLFPLIVPGNA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  2-2C->A: Fails to homodimerize.

Activity

  • Function:  Probable hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-2; 26-79; 38-78; 47-64; 49-66; 53-68
  • Structure ID:  AF-Q8K1D8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8K1D8-F1.pdbhor004133_AF2.pdbhor004133_ESM.pdb

Physical Information

Mass: 1020700 Formula: C356H576N112O118S14
Absent amino acids: Common amino acids: CS
pI: 7.82 Basic residues: 9
Polar residues: 37 Hydrophobic residues: 21
Hydrophobicity: -8.41 Boman Index: -13996
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 54.76
Instability Index: 3639.88 Extinction Coefficient cystines: 13115
Absorbance 280nm: 161.91

Literature

  • PubMed ID:  NA
  • Title:  NA